PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_009541
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family LBD
Protein Properties Length: 172aa    MW: 19104.3 Da    PI: 5.207
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_009541genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.56.1e-4051051101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+C+ dC+++pyfp ++p++fa vh++FGasnv k+l++lp + r +a+++l+yeA++r+++Pv+G+vg+i++l+++++++++ela+++
  DCAR_009541   5 RCAACKYLRRRCPVDCIFSPYFPPTNPHRFASVHRIFGASNVGKMLQQLPVHLRGEAAETLYYEAQCRIENPVHGCVGIITQLHEEINNAEQELARAQ 102
                  6***********************************************************************************************99 PP

       DUF260  99 eel 101
                  ++l
  DCAR_009541 103 AQL 105
                  885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.0864105IPR004883Lateral organ boundaries, LOB
PfamPF031955.0E-405102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MNTGRCAACK YLRRRCPVDC IFSPYFPPTN PHRFASVHRI FGASNVGKML QQLPVHLRGE  60
AAETLYYEAQ CRIENPVHGC VGIITQLHEE INNAEQELAR AQAQLAVHQP HHHHHQQEIE  120
EAVTGEGAEP MVPGDHAQEV AAEVAGNVED SDQNEFDIAA LMSPSDPDWF Y*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308220.11e-55PREDICTED: LOB domain-containing protein 24-like
SwissprotP594681e-50LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A061FP583e-55A0A061FP58_THECC; LOB domain-containing protein 23
STRINGPOPTR_0012s13910.14e-52(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52772039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.14e-45LOB domain-containing protein 24